VIP
Vasoactive Intestinal Peptide
28-amino-acid neuropeptide of the secretin/glucagon family, studied as a research probe for VPAC receptor pharmacology, vasodilation, and immune modulation.
- Molecular weight
- 3326 Da
- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Synonyms
- Vasoactive Intestinal Polypeptide, Intestinal vasodilator
What is VIP?
Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide widely expressed in the central and peripheral nervous systems and in many endocrine and immune cells. It is a member of the secretin/glucagon peptide family and acts via two GPCRs: VPAC1 and VPAC2. VIP is studied as both a basic neuroscience tool and a research probe for receptor pharmacology.
Mechanism of action (preclinical evidence)
VIP binds VPAC1 and VPAC2 with high affinity, activating Gαs-coupled adenylyl cyclase and cAMP-dependent signaling. Downstream effects include smooth muscle relaxation (vasodilation, bronchodilation), modulation of intestinal motility and water/electrolyte secretion, neuroprotection in CNS injury models, and anti-inflammatory effects via shifts in T-cell and macrophage cytokine profiles.
Research applications
- VPAC1/VPAC2 receptor binding and selectivity studies
- Smooth muscle relaxation models (vascular and bronchial)
- Intestinal secretion and motility research
- Neuroprotection in stroke and traumatic brain injury models
- Immune modulation and Th1/Th2 polarization studies
Storage and handling
Store lyophilised VIP at -20 °C in sealed, light-protected vials. Reconstituted solutions are relatively unstable; single-use aliquots and protein-low-binding tubes are recommended for cell-based assays.
Regulatory status
VIP is a naturally occurring peptide. The synthetic form supplied by Peptra Labs is for laboratory research only and is not approved as a therapeutic agent in any major regulatory framework.
Order VIP for research
≥99% HPLC purity · COA included · EU shipping
View product detailsReferences
Last reviewed: 4 May 2026