Skip to main content
🚚 Free EU & UK shipping over €300🎁 10% OFF first order - code LAUNCH10🧪 Purity tested by batch where applicable📋 CoA available where applicable
Back to peptides

VIP

Vasoactive Intestinal Peptide

28-amino-acid neuropeptide of the secretin/glucagon family, studied as a research probe for VPAC receptor pharmacology, vasodilation, and immune modulation.

Buy VIP
Molecular weight
3326 Da
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Synonyms
Vasoactive Intestinal Polypeptide, Intestinal vasodilator

What is VIP?

Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide widely expressed in the central and peripheral nervous systems and in many endocrine and immune cells. It is a member of the secretin/glucagon peptide family and acts via two GPCRs: VPAC1 and VPAC2. VIP is studied as both a basic neuroscience tool and a research probe for receptor pharmacology.

Mechanism of action (preclinical evidence)

VIP signaling is mediated primarily through two G-protein-coupled receptors, VPAC1 and VPAC2, both of which couple to Gαs and elevate intracellular cAMP through adenylyl cyclase activation. VPAC1 is broadly expressed in lung, liver, intestinal epithelium, and on T-lymphocytes; VPAC2 is concentrated in smooth muscle, the suprachiasmatic nucleus (where it regulates circadian rhythm), and on multiple immune cell types. Upon receptor binding, the cAMP/PKA cascade leads to phosphorylation of CREB and downstream transcriptional changes that broadly favor anti-inflammatory and trophic outcomes. Within the immune system, VIP has been characterized as a 'master immunomodulator': preclinical studies report it suppresses Th1 pro-inflammatory cytokine production (IFN-γ, IL-2, TNF-α), promotes a tolerogenic dendritic-cell phenotype, induces regulatory T-cell expansion, and downregulates NF-κB activity in macrophages. In airway smooth muscle, VPAC2 activation drives bronchodilation - the basis for early clinical interest in VIP analogues for asthma and COPD. In neurons, VIP is a non-adrenergic, non-cholinergic (NANC) transmitter and acts as a neuroprotective factor in models of cerebral ischemia, traumatic brain injury, and neurodegeneration. The peptide also has direct vasodilatory effects on vascular smooth muscle, contributing to its name. The breadth of these effects reflects VIP's evolutionary role as an integrating signal between the nervous, immune, and endocrine systems.

Research applications

  • VPAC1/VPAC2 receptor binding and selectivity studies
  • Smooth muscle relaxation models (vascular and bronchial)
  • Intestinal secretion and motility research
  • Neuroprotection in stroke and traumatic brain injury models
  • Immune modulation and Th1/Th2 polarization studies

Storage and handling

Store lyophilised VIP at -20 °C in sealed, light-protected vials. Reconstituted solutions are relatively unstable; single-use aliquots and protein-low-binding tubes are recommended for cell-based assays.

Regulatory status

VIP is a naturally occurring peptide. The synthetic form supplied by Peptra Labs is for laboratory research only and is not approved as a therapeutic agent in any major regulatory framework.

Order VIP for research

Purity data where applicable · CoA available where applicable · EU shipping

View product details

Frequently asked questions

What is Vasoactive Intestinal Peptide (VIP)?+
VIP is a 28-amino-acid endogenous peptide hormone in the secretin/glucagon superfamily, originally isolated from porcine intestine in 1970. It is produced naturally by neurons, immune cells, and endocrine cells throughout the body and acts as a neurotransmitter, immunomodulator, and vasodilator.
What are the main VIP receptors?+
VIP signals through two G-protein-coupled receptors: VPAC1 (broadly expressed in lung, liver, lymphocytes) and VPAC2 (expressed in smooth muscle, brain, immune cells). Both activate cAMP/PKA signaling. Selective VPAC1 and VPAC2 agonists exist for receptor-specific preclinical research.
What conditions are studied with VIP in preclinical research?+
Preclinical VIP research focuses on autoimmune disease models (experimental autoimmune encephalomyelitis, collagen-induced arthritis, IBD), pulmonary conditions (sarcoidosis, pulmonary fibrosis), neuroinflammation, and circadian rhythm biology (VIP neurons in the suprachiasmatic nucleus).
Is VIP approved for human use?+
No. VIP is not FDA-approved as a drug. A modified VIP analogue (aviptadil) has been investigated for pulmonary hypertension and ARDS in clinical trials but has not received broad regulatory approval. The research material here is strictly for preclinical laboratory study.
How is VIP stored?+
Lyophilized VIP is stable at -20°C in a sealed, light-protected vial. Once reconstituted in sterile water with a carrier protein (BSA or HSA recommended to prevent adsorption), aliquot and store at -80°C for long-term use or at 2-8°C for short-term (max 7 days).

References

  1. Said SI, Mutt V. Polypeptide with broad biological activity: isolation from small intestine. Science. 1970;169(3951):1217-1218.
  2. Delgado M, Ganea D. Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. 2013;45(1):25-39.

Last reviewed: 4 May 2026