Skip to main content
🚚 Free EU & UK shipping over €300🎁 10% OFF first order — code LAUNCH10🧪 HPLC-MS Verified · ≥99% Purity📋 Certificate of Analysis available
Back to peptides

VIP

Vasoactive Intestinal Peptide

28-amino-acid neuropeptide of the secretin/glucagon family, studied as a research probe for VPAC receptor pharmacology, vasodilation, and immune modulation.

Buy VIP
Molecular weight
3326 Da
Sequence
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Synonyms
Vasoactive Intestinal Polypeptide, Intestinal vasodilator

What is VIP?

Vasoactive Intestinal Peptide (VIP) is a 28-amino-acid neuropeptide widely expressed in the central and peripheral nervous systems and in many endocrine and immune cells. It is a member of the secretin/glucagon peptide family and acts via two GPCRs: VPAC1 and VPAC2. VIP is studied as both a basic neuroscience tool and a research probe for receptor pharmacology.

Mechanism of action (preclinical evidence)

VIP binds VPAC1 and VPAC2 with high affinity, activating Gαs-coupled adenylyl cyclase and cAMP-dependent signaling. Downstream effects include smooth muscle relaxation (vasodilation, bronchodilation), modulation of intestinal motility and water/electrolyte secretion, neuroprotection in CNS injury models, and anti-inflammatory effects via shifts in T-cell and macrophage cytokine profiles.

Research applications

  • VPAC1/VPAC2 receptor binding and selectivity studies
  • Smooth muscle relaxation models (vascular and bronchial)
  • Intestinal secretion and motility research
  • Neuroprotection in stroke and traumatic brain injury models
  • Immune modulation and Th1/Th2 polarization studies

Storage and handling

Store lyophilised VIP at -20 °C in sealed, light-protected vials. Reconstituted solutions are relatively unstable; single-use aliquots and protein-low-binding tubes are recommended for cell-based assays.

Regulatory status

VIP is a naturally occurring peptide. The synthetic form supplied by Peptra Labs is for laboratory research only and is not approved as a therapeutic agent in any major regulatory framework.

Order VIP for research

≥99% HPLC purity · COA included · EU shipping

View product details

References

  1. Said SI, Mutt V. Polypeptide with broad biological activity: isolation from small intestine. Science. 1970;169(3951):1217-1218.
  2. Delgado M, Ganea D. Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. 2013;45(1):25-39.

Last reviewed: 4 May 2026