Skip to main content
🚚 Free EU & UK shipping over €300🎁 10% OFF first order - code LAUNCH10🧪 Purity tested by batch where applicable📋 CoA available where applicable
VIP

VIP

Vasoactive Intestinal Peptide, a 28-amino-acid neuropeptide with broad functions spanning vasodilation, immune modulation, neuroprotection, and circadian rhythm regulation. All presented information is based on scientific publications which can be found at the end of product description below.

10mg
From €59.00
In stock
1
VIP-
€59.00
Purity testedBatch traceabilityCoA information where available🇪🇺 EU Shipped

Batch-level quality proof

Every research peptide is supplied as a sealed, clearly labelled vial. Batch-level CoA information and purity testing records are available online where applicable, not shipped as research paperwork in the parcel.

Sealed vial

Clear label, lot traceability, protective packaging.

CoA where applicable

No COA report currently listed for this product/batch.

RUO boundary

Not for human or veterinary use, no protocol or dosing advice.

When this product is not suitable: Do not order for personal use, clinical use, injection, compounding, resale as a supplement, or any project that requires a specific assay not shown for the relevant batch.

VIP research authority cluster

Use these pages to connect VIP product data, the VPAC1/VPAC2 peptide hub, RUO policy, and CoA information where applicable.


Product specifications

Quantity
10 mg
Unit
1 vial
Physical appearance
White powder
Salt form
Acetate
Purity data
≥97%
Sequence
His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Molecular mass
3326.82
CAS number
37221-79-7
Solubility
Sterile / bacteriostatic water, 1 mL/vial

Description

All presented information is based on scientific publications which can be found at the end of product description below.

VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide signaling through VPAC1 and VPAC2 receptors, mediating diverse physiological functions across the nervous, immune, and gastrointestinal systems. Research Highlights 1. Immune Modulation — Inhibits pro-inflammatory cytokines (TNF-α, IL-6, IL-12) while promoting IL-10.

2. Neuroprotection — Promotes neuronal survival against oxidative stress, excitotoxicity, and amyloid-beta toxicity.

3. Pulmonary Function — Bronchodilator and pulmonary pressure regulator. Investigated for pulmonary arterial hypertension.

4. GI Regulation — Relaxes smooth muscle, stimulates secretion, modulates intestinal motility.

5. Circadian Rhythm — VIP-expressing SCN neurons essential for circadian rhythmicity.

6. Reproductive Biology — Influences steroidogenesis, uterine contractility, and erectile function. References available upon request. The product is intended for scientific research and development purposes only. Chemical substances shall not be used as a drug, medicine, active substance, medical aid, cosmetic product, a substance for production of a cosmetic product neither for human consumption that is any food or food supplement or otherwise similarly used on humans or animals. Intended only for in-vitro research, such as Receptor-ligand binding studies, Enzyme activity assays, Cell proliferation assays, Cell signaling assays, Epitope mapping, etc.

Research Use Only: The product is intended for scientific research and development purposes only. Chemical substances shall not be used as a drug, medicine, active substance, medical aid, cosmetic product, a substance for production of a cosmetic product neither for human consumption that is any food or food supplement or otherwise similarly used on humans or animals. Intended only for in-vitro research, such as Receptor-ligand binding studies, Enzyme activity assays, Cell proliferation assays, Cell signaling assays, Epitope mapping, etc.

No COA report currently listed for this product/batch.

View CoA archive / request available information

🇪🇺 EU & UK shipping • Free over €300 • estimated at checkout

Frequently asked questions

  • VIP (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide with sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2. Molecular weight is approximately 3326 Da. It is a member of the secretin/glucagon family of peptides.